MED10 Antibody
| Name | MED10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81328 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS |
| Description | Rabbit Polyclonal |
| Gene | MED10 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: MED10 Antibody [NBP1-81328] Staining of human kidney shows strong cytoplasmic positivity in distal renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23874_MED10%2520Antibody-Immunohistochemistry-Paraffin-NBP1-81328-img0002.jpg)
Immunohistochemistry-Paraffin: MED10 Antibody [NBP1-81328] Staining of human kidney shows strong cytoplasmic positivity in distal renal tubules.