ZFYVE28 Antibody
| Name | ZFYVE28 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81390 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GMKLSATVIFNPKSPTSLDSAVATQEAASEPVAEGMDGGPHKLSTGATNCLLHSCVCCGSCGDSREDVVERLREKC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZFYVE28 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZFYVE28 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ZFYVE28 Antibody [NBP1-81390] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23899_ZFYVE28-Antibody-Immunohistochemistry-NBP1-81390-img0003.jpg)
Immunohistochemistry: ZFYVE28 Antibody [NBP1-81390] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.