ZNF706 Antibody
| Name | ZNF706 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81683 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELAD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF706 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZNF706 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ZNF706 Antibody [NBP1-81683] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/5187_ZNF706-Antibody-Immunohistochemistry-Paraffin-NBP1-81683-img0003.jpg)
Immunohistochemistry-Paraffin: ZNF706 Antibody [NBP1-81683] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.