MPV17L Antibody
| Name | MPV17L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83466 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SQQSGDGTFKSAFTILYTKGTSATEGYPKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MPV17L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MPV17L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: MPV17L Antibody [NBP1-83466] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4990_MPV17L%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83466-img0004.jpg)
![Immunohistochemistry: MPV17L Antibody [NBP1-83466] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4991_MPV17L-Antibody-Immunohistochemistry-NBP1-83466-img0003.jpg)