DNAJC22 Antibody
| Name | DNAJC22 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82261 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:WKLPSFVAQANRAQGQRQSPRGVTPPLSPIRF |
| Description | Rabbit Polyclonal |
| Gene | DNAJC22 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: DNAJC22 Antibody [NBP1-82261] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24059_DNAJC22-Antibody-Immunohistochemistry-NBP1-82261-img0003.jpg)
Immunohistochemistry: DNAJC22 Antibody [NBP1-82261] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.