NK2R Antibody
| Name | NK2R Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82562 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TACR2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: NK2R Antibody [NBP1-82562] - Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24077_NK2R-Antibody-Immunohistochemistry-NBP1-82562-img0003.jpg)
Immunohistochemistry: NK2R Antibody [NBP1-82562] - Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.