ZNF276 Antibody
| Name | ZNF276 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82681 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF276 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF276 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZNF276 Antibody [NBP1-82681] - Staining of human cell line A-431 shows positivity in nucleoli, cytoplasm, cell junctions & nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8791_ZNF276-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82681-img0004.jpg)
Immunocytochemistry/Immunofluorescence: ZNF276 Antibody [NBP1-82681] - Staining of human cell line A-431 shows positivity in nucleoli, cytoplasm, cell junctions & nucleus but excluded from the nucleoli.
![Immunohistochemistry: ZNF276 Antibody [NBP1-82681] - Staining of human cerebellum shows nuclear and cytoplasmic positivity in Purkinje and molecular layer cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8792_ZNF276-Antibody-Immunohistochemistry-NBP1-82681-img0003.jpg)
Immunohistochemistry: ZNF276 Antibody [NBP1-82681] - Staining of human cerebellum shows nuclear and cytoplasmic positivity in Purkinje and molecular layer cells.