KIF9 Antibody
| Name | KIF9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82773 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KIF9 Protein |
| Description | Rabbit Polyclonal |
| Gene | KIF9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: KIF9 Antibody [NBP1-82773] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14928_KIF9-Antibody-Western-Blot-NBP1-82773-img0005.jpg)
Western Blot: KIF9 Antibody [NBP1-82773] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.
![Immunocytochemistry/Immunofluorescence: KIF9 Antibody [NBP1-82773] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14929_KIF9%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82773-img0007.jpg)
Immunocytochemistry/Immunofluorescence: KIF9 Antibody [NBP1-82773] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli.
![Immunocytochemistry/Immunofluorescence: KIF9 Antibody [NBP1-82773] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14930_KIF9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82773-img0006.jpg)
Immunocytochemistry/Immunofluorescence: KIF9 Antibody [NBP1-82773] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.