GPR133 Antibody
| Name | GPR133 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85142 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GPR133 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADGRD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: GPR133 Antibody [NBP1-85142] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells with distinct extracellular material.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2816_GPR133-Antibody-Immunohistochemistry-NBP1-85142-img0003.jpg)
Immunohistochemistry: GPR133 Antibody [NBP1-85142] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells with distinct extracellular material.