SV2C Antibody

Name SV2C Antibody
Supplier Novus Biologicals
Catalog NBP1-86239
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:GEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYE
Purity/Format Immunogen affinity purified
Blocking Peptide SV2C Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SV2C
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.