ARV1 Antibody
| Name | ARV1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86300 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QGKGNVDGVAATPTAASASCQYRCIECNQEAKELYRDYNHGVLKITICKSCQKP |
| Description | Rabbit Polyclonal |
| Gene | ARV1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ARV1 Antibody [NBP1-86300] - Staining of human heart muscle shows strong cytoplasmic and membranous positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24276_ARV1-Antibody-Immunohistochemistry-NBP1-86300-img0004.jpg)
Immunohistochemistry: ARV1 Antibody [NBP1-86300] - Staining of human heart muscle shows strong cytoplasmic and membranous positivity in myocytes.