LDLRAD3 Antibody
| Name | LDLRAD3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86261 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASEVGSPPSYSEALLDQRPA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LDLRAD3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LDLRAD3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: LDLRAD3 Antibody [NBP1-86261] - Immunofluorescent staining of human cell line U-2 OS shows localization to cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26413_LDLRAD3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86261-img0005.jpg)
Immunocytochemistry/Immunofluorescence: LDLRAD3 Antibody [NBP1-86261] - Immunofluorescent staining of human cell line U-2 OS shows localization to cell junctions.
![Immunohistochemistry: LDLRAD3 Antibody [NBP1-86261] - Staining of human fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26414_LDLRAD3-Antibody-Immunohistochemistry-NBP1-86261-img0003.jpg)
Immunohistochemistry: LDLRAD3 Antibody [NBP1-86261] - Staining of human fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.