ARL9 Antibody
| Name | ARL9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86284 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VLHSLASNRVQHSVAPTQGFHAVCINTEDSQMEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVV |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ARL9 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ARL9 Antibody [NBP1-86284] Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24292_ARL9%2520Antibody-Immunohistochemistry-Paraffin-NBP1-86284-img0002.jpg)
Immunohistochemistry-Paraffin: ARL9 Antibody [NBP1-86284] Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.