CYP39A1 Antibody
| Name | CYP39A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86347 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SHPDIHKAIMEGISSVFGKAGKDKIKVSEDDLENLLLIKWCVLETIRLKAPGVITR |
| Description | Rabbit Polyclonal |
| Gene | CYP39A1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CYP39A1 Antibody [NBP1-86347] - Staining of human salivary gland shows strong positivity in myoepithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24297_CYP39A1-Antibody-Immunohistochemistry-NBP1-86347-img0003.jpg)
Immunohistochemistry: CYP39A1 Antibody [NBP1-86347] - Staining of human salivary gland shows strong positivity in myoepithelial cells.