CDS2 Antibody
| Name | CDS2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86435 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CDS2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CDS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: CDS2 Antibody [NBP1-86435] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8413_CDS2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86435-img0004.jpg)
![Immunohistochemistry: CDS2 Antibody [NBP1-86435] - Staining of human hippocampus shows cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8414_CDS2-Antibody-Immunohistochemistry-NBP1-86435-img0002.jpg)