Wnt16 Antibody

Name Wnt16 Antibody
Supplier Novus Biologicals
Catalog NBP1-86403
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:AVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNY
Purity/Format Immunogen affinity purified
Blocking Peptide Wnt16 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene WNT16
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.