MTMR7 Antibody
| Name | MTMR7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86511 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AHLWKNRADYLNPLFRADHSQTQGTLHLPTTPCNFMYKFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQLEEELEAL |
| Description | Rabbit Polyclonal |
| Gene | MTMR7 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: MTMR7 Antibody [NBP1-86511] - Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24367_MTMR7-Antibody-Immunohistochemistry-NBP1-86511-img0003.jpg)
Immunohistochemistry: MTMR7 Antibody [NBP1-86511] - Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.