MURC Antibody
| Name | MURC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86609 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KGKDRTVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKVEDDESLLL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MURC Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MURC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: MURC Antibody [NBP1-86609] - Staining of human skeletal muscle shows distinct cytoplasmic and membranous positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19861_MURC-Antibody-Immunohistochemistry-NBP1-86609-img0003.jpg)
Immunohistochemistry: MURC Antibody [NBP1-86609] - Staining of human skeletal muscle shows distinct cytoplasmic and membranous positivity in myocytes.