TBC1D22B Antibody
| Name | TBC1D22B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86753 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LVARISDQNASGAPPMTVREKTRLEKFRQLLSSQNTDLDELRKCSWPGVPREVRPITWR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TBC1D22B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TBC1D22B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: TBC1D22B Antibody [NBP1-86753] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2018_TBC1D22B-Antibody-Immunohistochemistry-NBP1-86753-img0003.jpg)
Immunohistochemistry: TBC1D22B Antibody [NBP1-86753] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.