TauT/SLC6A6 Antibody

Name TauT/SLC6A6 Antibody
Supplier Novus Biologicals
Catalog NBP1-86965
Prices $129.00, $419.00
Sizes 25 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:ATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGIDHP
Purity/Format Immunogen affinity purified
Blocking Peptide TauT/SLC6A6 Protein
Description Rabbit Polyclonal
Gene SLC6A6
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.