ACSM3 Antibody
| Name | ACSM3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87098 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ACSM3 Protein |
| Description | Rabbit Polyclonal |
| Gene | ACSM3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ACSM3 Antibody [NBP1-87098] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4176_ACSM3-Antibody-Immunohistochemistry-NBP1-87098-img0003.jpg)
Immunohistochemistry: ACSM3 Antibody [NBP1-87098] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.