C4orf21/prematurely terminated mRNA decay factor-like Antibody
| Name | C4orf21/prematurely terminated mRNA decay factor-like Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83750 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ESEQLKELHALMKEDLTPTERVYVRKSIEQHKLGTNRTLLKQVRVVGVTCAACPFPCMNDLKFPVVVLDECSQITEPASLLPIARFEC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C4orf21/prematurely terminated mRNA decay factor-like Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZGRF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunodiffusion: C4orf21/prematurely terminated mRNA decay factor-like Antibody [NBP1-83750] - Staining of human placenta shows moderate cytoplasmic and membranous positivity in decidual and trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1128_C4orf21-prematurely-terminated-mRNA-decay-factor-like-Antibody-Immunodiffusion-NBP1-83750-img0002.jpg)
Immunodiffusion: C4orf21/prematurely terminated mRNA decay factor-like Antibody [NBP1-83750] - Staining of human placenta shows moderate cytoplasmic and membranous positivity in decidual and trophoblastic cells.