DNAH6 Antibody
| Name | DNAH6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84068 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QQGTLSDAEWNFFLRGSAGLEKERPPKPEAPWLPTATWFACCDLEESFPVFHGLTQNILSHPISIRLGSFETYINPQKWEGYSKMKHEDK |
| Description | Rabbit Polyclonal |
| Gene | DNAH6 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: DNAH6 Antibody [NBP1-84068] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24489_DNAH6-Antibody-Immunohistochemistry-NBP1-84068-img0004.jpg)
Immunohistochemistry: DNAH6 Antibody [NBP1-84068] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.