TMEM55A Antibody
| Name | TMEM55A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84086 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TMEM55A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TMEM55A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: TMEM55A Antibody [NBP1-84086] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2358_TMEM55A-Antibody-Immunohistochemistry-NBP1-84086-img0002.jpg)
Immunohistochemistry: TMEM55A Antibody [NBP1-84086] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.