FCRL1/FcRH1 Antibody
| Name | FCRL1/FcRH1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84703 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FCRL1/FcRH1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FCRL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: FCRL1/FcRH1 Antibody [NBP1-84703] - Staining of human salivary gland shows cytoplasmic positivity in glandular cells and immune cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22699_FCRL1-FcRH1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-84703-img0004.jpg)
Immunohistochemistry-Paraffin: FCRL1/FcRH1 Antibody [NBP1-84703] - Staining of human salivary gland shows cytoplasmic positivity in glandular cells and immune cells.