OLFML2A Antibody
| Name | OLFML2A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84655 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PTSIPATTTTATTTPTPTTSLLPTEPPSGPEVSSQGREASCEGTLRAVDPPVRHHSYGRHEGAWMKDPAARDDRIYVTNYYY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | OLFML2A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | OLFML2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: OLFML2A Antibody [NBP1-84655] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9139_OLFML2A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84655-img0005.jpg)
![Immunohistochemistry: OLFML2A Antibody [NBP1-84655] - Staining of human stomach shows strong positivity in the gastric pits.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9140_OLFML2A-Antibody-Immunohistochemistry-NBP1-84655-img0003.jpg)