MAST1 Antibody
| Name | MAST1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81453 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TLERDVGCTRHQSVQTEDGTGGMARAVAKAALSPVQEHETGRRSSSGEAGTPLVPIVVEPARPGAKAVVPQPLGADSKGLQEPA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MAST1 Protein |
| Description | Rabbit Polyclonal |
| Gene | CLASP1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: MAST1 Antibody [NBP1-81453] - Staining of human stomach shows moderate nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24559_MAST1-Antibody-Immunohistochemistry-NBP1-81453-img0003.jpg)
Immunohistochemistry: MAST1 Antibody [NBP1-81453] - Staining of human stomach shows moderate nuclear positivity in glandular cells.