ITPKB Antibody
| Name | ITPKB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81589 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ITPKB Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ITPKB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human cerebral cortex shows strong positivity in astrocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26047_ITPKB-Antibody-Immunohistochemistry-Paraffin-NBP1-81589-img0001.jpg)
Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human cerebral cortex shows strong positivity in astrocytes.