RNF24 Antibody
| Name | RNF24 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81859 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:IRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RNF24 Protein |
| Description | Rabbit Polyclonal |
| Gene | RNF24 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: RNF24 Antibody [NBP1-81859] - Staining of human cell line SiHa shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5232_RNF24-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81859-img0004.jpg)
![Immunohistochemistry: RNF24 Antibody [NBP1-81859] - Staining of human duodenum shows moderate positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5233_RNF24-Antibody-Immunohistochemistry-NBP1-81859-img0003.jpg)