C5orf48 Antibody
| Name | C5orf48 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82044 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AEVCGIHTGPLEDSLFLNHSERLCHGEDRKVVFQKGPPEIKIADMPLHSPLSRYQSTVISHGFRRRLV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C5orf48 Protein |
| Description | Rabbit Polyclonal |
| Gene | TEX43 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: C5orf48 Antibody [NBP1-82044] Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24636_C5orf48%2520Antibody-Immunohistochemistry-Paraffin-NBP1-82044-img0002.jpg)
Immunohistochemistry-Paraffin: C5orf48 Antibody [NBP1-82044] Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.