CCDC38 Antibody
| Name | CCDC38 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81919 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLPTLNSGGKVKDGSTKEDRPYKIFFRDLFLVKENEMAAKETEKFMNRNMKVYQKTTFSSRMKSHSYLSQLAFYPKRSGRSFEKFGPGPA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC38 Protein |
| Description | Rabbit Polyclonal |
| Gene | CCDC38 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CCDC38 Antibody [NBP1-81919] - Staining of human placenta shows strong cytoplasmic positivity in decidual cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24653_CCDC38-Antibody-Immunohistochemistry-NBP1-81919-img0002.jpg)
Immunohistochemistry: CCDC38 Antibody [NBP1-81919] - Staining of human placenta shows strong cytoplasmic positivity in decidual cells.