COLEC10 Antibody
| Name | COLEC10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84442 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KDEAANTLIADYVAKSGFFRVFIGVNDLEREGQYMFTDNTPLQNYSNWNEGEPSDPYGHEDCVEMLSSGRWNDTECHLTMYFVCEFIKKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | COLEC10 Protein |
| Description | Rabbit Polyclonal |
| Gene | COLEC10 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: COLEC10 Antibody [NBP1-84442] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes and bile ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24691_COLEC10-Antibody-Immunohistochemistry-NBP1-84442-img0002.jpg)
Immunohistochemistry: COLEC10 Antibody [NBP1-84442] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes and bile ducts.