SSR2 Antibody
| Name | SSR2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80678 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWA |
| Description | Rabbit Polyclonal |
| Gene | SSR2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SSR2 Antibody [NBP1-80678] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24777_SSR2-Antibody-Immunohistochemistry-NBP1-80678-img0003.jpg)
Immunohistochemistry: SSR2 Antibody [NBP1-80678] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.