NBEAL2 Antibody
| Name | NBEAL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14752 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PLTPTEEASLPLAVTKEAKVSTPPELLQEDQLGEDELAELETPMEAAELD EQREKLVLSAECQLVTVVAVVPGLL |
| Description | Rabbit Polyclonal |
| Gene | NBEAL2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: NBEAL2 Antibody [NBP2-14752] - Staining of human stomach, lower shows moderate cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24791_NBEAL2-Antibody-Immunohistochemistry-Paraffin-NBP2-14752-img0002.jpg)
Immunohistochemistry-Paraffin: NBEAL2 Antibody [NBP2-14752] - Staining of human stomach, lower shows moderate cytoplasmic and nuclear positivity in glandular cells.