VPS13D Antibody
| Name | VPS13D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14742 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPP PFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | VPS13D Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | VPS13D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: VPS13D Antibody [NBP2-14742] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4954_VPS13D-Antibody-Immunohistochemistry-Paraffin-NBP2-14742-img0002.jpg)
Immunohistochemistry-Paraffin: VPS13D Antibody [NBP2-14742] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non germinal center cells.