C3orf55 Antibody
| Name | C3orf55 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14781 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCW IGGDLTNFKGCYLTNQLP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C3orf55 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PQLC2L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C3orf55 Antibody [NBP2-14781] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5931_C3orf55-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14781-img0002.jpg)
Immunocytochemistry/Immunofluorescence: C3orf55 Antibody [NBP2-14781] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & the Golgi apparatus.
![Immunohistochemistry-Paraffin: C3orf55 Antibody [NBP2-14781] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes and bile duct cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5932_C3orf55-Antibody-Immunohistochemistry-Paraffin-NBP2-14781-img0001.jpg)
Immunohistochemistry-Paraffin: C3orf55 Antibody [NBP2-14781] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes and bile duct cells.