DEFB113 Antibody
| Name | DEFB113 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14767 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: KRECQLVRGACKPECNSWEYVYYYCNVNPCCAVWEYQKPIINKI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DEFB113 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DEFB113 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: DEFB113 Antibody [NBP2-14767] Staining of human lateral ventricle shows strong vesicular positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24832_DEFB113%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14767-img0001.jpg)
Immunohistochemistry-Paraffin: DEFB113 Antibody [NBP2-14767] Staining of human lateral ventricle shows strong vesicular positivity in neuronal cells.