RNF144A Antibody
| Name | RNF144A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13238 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQR YKKLQFEREVLFDPCRTWCPASTCQAVC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RNF144A Protein |
| Description | Rabbit Polyclonal |
| Gene | RNF144A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: RNF144A Antibody [NBP2-13238] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11870_RNF144A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13238-img0003.jpg)
Immunocytochemistry/Immunofluorescence: RNF144A Antibody [NBP2-13238] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
![Immunohistochemistry-Paraffin: RNF144A Antibody [NBP2-13238] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11871_RNF144A-Antibody-Immunohistochemistry-Paraffin-NBP2-13238-img0001.jpg)
Immunohistochemistry-Paraffin: RNF144A Antibody [NBP2-13238] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.