RAB33B Antibody
| Name | RAB33B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13191 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RAB33B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RAB33B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: RAB33B Antibody [NBP2-13191] Staining of human stomach, lower shows distinct cytoplasmic positivity in superficial layer of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4231_RAB33B%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13191-img0001.jpg)
Immunohistochemistry-Paraffin: RAB33B Antibody [NBP2-13191] Staining of human stomach, lower shows distinct cytoplasmic positivity in superficial layer of glandular cells.