RFPL4A Antibody
| Name | RFPL4A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13222 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RFPL4A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RFPL4A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: RFPL4A Antibody [NBP2-13222] - Staining of human cell line U-2 OS shows localization to cytosol & centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9315_RFPL4A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13222-img0003.jpg)
Immunocytochemistry/Immunofluorescence: RFPL4A Antibody [NBP2-13222] - Staining of human cell line U-2 OS shows localization to cytosol & centrosome.
![Immunohistochemistry-Paraffin: RFPL4A Antibody [NBP2-13222] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9316_RFPL4A-Antibody-Immunohistochemistry-Paraffin-NBP2-13222-img0002.jpg)
Immunohistochemistry-Paraffin: RFPL4A Antibody [NBP2-13222] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.