SLC44A3 Antibody
| Name | SLC44A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13339 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-F IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: GAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEV KGTQLNRMALCVSNCPEEQLDSLEEVQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC44A3 Protein |
| Description | Rabbit Polyclonal |
| Gene | SLC44A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: SLC44A3 Antibody [NBP2-13339] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26524_SLC44A3-Antibody-Immunohistochemistry-Paraffin-NBP2-13339-img0003.jpg)
Immunohistochemistry-Paraffin: SLC44A3 Antibody [NBP2-13339] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
![Immunohistochemistry-Frozen: SLC44A3 Antibody [NBP2-13339] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26525_SLC44A3-Antibody-Immunohistochemistry-Frozen-NBP2-13339-img0002.jpg)
Immunohistochemistry-Frozen: SLC44A3 Antibody [NBP2-13339] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4