SLC36A3 Antibody
| Name | SLC36A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13335 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: CAQHLSQRLQKTFVNYGEATMYGLETCPNTWLRAHAV |
| Description | Rabbit Polyclonal |
| Gene | SLC36A3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: SLC36A3 Antibody [NBP2-13335] Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24885_SLC36A3%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13335-img0001.jpg)
Immunohistochemistry-Paraffin: SLC36A3 Antibody [NBP2-13335] Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.