SLC35F3 Antibody

Name SLC35F3 Antibody
Supplier Novus Biologicals
Catalog NBP2-13332
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: HVCKSTEKQSVKQRYRECCRFFGDNGLTLK
Purity/Format Immunogen affinity purified
Blocking Peptide SLC35F3 Protein
Description Rabbit Polyclonal
Gene SLC35F3
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.