SLC25A35 Antibody

Name SLC25A35 Antibody
Supplier Novus Biologicals
Catalog NBP2-13324
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: IYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGG LPRVIVGSSTQLCTFSSTKDLLSQ
Purity/Format Immunogen affinity purified
Blocking Peptide SLC25A35 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SLC25A35
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.