SorCS3 Antibody
| Name | SorCS3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13365 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PWINIYAQVQHDKEQEMIGSVSQSENAPKITLSDFTEPEELLDKELDTRV IGGIATIANSESTKEIPNCT |
| Description | Rabbit Polyclonal |
| Gene | SORCS3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: SORCS3 Antibody [NBP2-13365] Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24918_SORCS3%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13365-img0001.jpg)
Immunohistochemistry-Paraffin: SORCS3 Antibody [NBP2-13365] Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.