NTN4 Antibody
| Name | NTN4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13680 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: AGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDLTCR QPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHRE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NTN4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MLF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: NTN4 Antibody [NBP2-13680] Staining of human kidney shows moderate membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20550_NTN4%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13680-img0001.jpg)
Immunohistochemistry-Paraffin: NTN4 Antibody [NBP2-13680] Staining of human kidney shows moderate membranous positivity in cells in tubules.