TTLL13 Antibody
| Name | TTLL13 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13492 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSFTTDSCLDQEVKDALLCDAMTLVNLRGCDKRKVMEEDKRRVKERLFQC YRQPRESRCARCLACV |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TTLL13P |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: TTLL13 Antibody [NBP2-13492] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24986_TTLL13-Antibody-Immunohistochemistry-NBP2-13492-img0002.jpg)
Immunohistochemistry: TTLL13 Antibody [NBP2-13492] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.