TTLL1 Antibody
| Name | TTLL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13491 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKEVLGNYEIL YDEELAQGDGADRELRSRQGQSLGPRAGRSRDSGRAVLTTWK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TTLL1 Protein |
| Description | Rabbit Polyclonal |
| Gene | TTLL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TTLL1 Antibody [NBP2-13491] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11889_TTLL1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13491-img0004.jpg)
Immunocytochemistry/Immunofluorescence: TTLL1 Antibody [NBP2-13491] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.
![Immunohistochemistry-Paraffin: TTLL1 Antibody [NBP2-13491] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11890_TTLL1-Antibody-Immunohistochemistry-Paraffin-NBP2-13491-img0002.jpg)
Immunohistochemistry-Paraffin: TTLL1 Antibody [NBP2-13491] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.