TRIM61 Antibody
| Name | TRIM61 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13485 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLEEYNAPWKERVELIEKVITMQTRKSLELKKKMESPSV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TRIM61 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRIM61 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TRIM61 Antibody [NBP2-13485] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10777_TRIM61-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13485-img0002.jpg)
Immunocytochemistry/Immunofluorescence: TRIM61 Antibody [NBP2-13485] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & endoplasmic reticulum.
![Immunohistochemistry-Paraffin: TRIM61 Antibody [NBP2-13485] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10778_TRIM61-Antibody-Immunohistochemistry-Paraffin-NBP2-13485-img0001.jpg)
Immunohistochemistry-Paraffin: TRIM61 Antibody [NBP2-13485] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.