SYPL2 Antibody
| Name | SYPL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13406 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: ETGAMVRCNNEAKDVSSIIVAFGYPFRLHRIQYEMPLCDEESSSKTMHLM GDFSAP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SYPL2 Protein |
| Description | Rabbit Polyclonal |
| Gene | SYPL2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SYPL2 Antibody [NBP2-13406] - Staining of human lymph node shows strong nuclear positivity in germinal and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24999_SYPL2-Antibody-Immunohistochemistry-NBP2-13406-img0002.jpg)
Immunohistochemistry: SYPL2 Antibody [NBP2-13406] - Staining of human lymph node shows strong nuclear positivity in germinal and non-germinal center cells.